PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_020134-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 170aa    MW: 19655.5 Da    PI: 9.5061
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_020134-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
    NNU_020134-RA 14 RGLWSPEEDENLIQYINAHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding569e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ ++ + G++ W+ Ia++++ gRt++++k++w+++
    NNU_020134-RA  67 RGRFTPEEEKLIISLHGLVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.337961IPR017930Myb domain
SuperFamilySSF466898.27E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
PfamPF002496.6E-161461IPR001005SANT/Myb domain
CDDcd001675.92E-111761No hitNo description
PROSITE profilePS5129426.20862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2665116IPR009057Homeodomain-like
SMARTSM007172.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.5E-1667111IPR001005SANT/Myb domain
CDDcd001676.86E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDENLIQYIN AHGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIKRGRF TPEEEKLIIS LHGLVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPS  120
ATPAMVPSNV KFVQSGYTWN QLDTVNQDLA TIKAPIEERV FSSSCPLFMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276890.11e-126PREDICTED: myb-related protein Myb4-like
SwissprotQ9SPG35e-65MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A151TJX79e-99A0A151TJX7_CAJCA; Transcription factor MYB86
STRINGVIT_02s0025g00320.t014e-97(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.17e-86myb domain protein 103